SKU: TSM10kit

Tesamorelin | The 10 Pack

Specification Details
Compound Tesamorelin
Type Synthetic GHRH analogue
Quantity 10 mg
Purity ≥99% HPLC Certified
Form Lyophilized powder
Appearance White to off-white powder
Solubility Soluble in laboratory-grade sterile water
Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular Formula C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight 5136 g/mol
CAS Number 218949-48-5
Documentation COA included in product image gallery

$675.00

For Research Use Only | Not for Human or Veterinary Use

Description

Tesamorelin is a synthetic analogue of growth hormone-releasing hormone (GHRH). It is based on the 44-amino-acid human GHRH sequence and contains a C-terminal modification that contributes to its stability as a GHRH analogue.

This research material is supplied as a lyophilized powder for laboratory research, analytical testing, and related scientific applications.

PubChem identifies tesamorelin with the molecular formula C₂₂₁H₃₆₆N₇₂O₆₇S, molecular weight of approximately 5136 g/mol, and CAS number 218949-48-5. PubChem also lists the 44-residue sequence associated with tesamorelin.

Research & Scientific Context

Tesamorelin is structurally related to human GHRH, a 44-amino-acid hypothalamic peptide involved in regulation of growth hormone secretion. GHRH acts through the GHRH receptor, a G-protein-coupled receptor expressed on pituitary somatotroph cells.

The tesamorelin sequence corresponds to GHRH residues 1–44 with a C-terminal modification. This structural design has been studied in relation to GHRH receptor signaling and the regulation of the growth hormone axis.

Key Research Characteristics

Synthetic GHRH analogue

44-amino-acid peptide sequence

GHRH receptor-related research

Growth hormone axis research

Peptide structure and characterization

Endocrine and receptor-signaling studies

Tesamorelin and GHRH

Tesamorelin is derived from the sequence of human GHRH but is not simply native GHRH. Its structure includes a C-terminal modification, represented in the chemical record by the modified terminal portion of the molecule.

Feature Human GHRH Tesamorelin
Peptide length 44 amino acids 44 amino acids
Relationship Endogenous hypothalamic peptide Synthetic GHRH analogue
Receptor research GHRH receptor GHRH receptor
C-terminal structure Amidated native peptide Modified C-terminal structure

Human GHRH was originally characterized as a 44-residue amidated peptide, while tesamorelin was developed as a stabilized synthetic analogue.

Regulatory & Research Status

Tesamorelin has a documented U.S. regulatory history. The FDA's Purple Book lists Egrifta, Egrifta SV, and Egrifta WR as licensed biological products containing tesamorelin, with the original approval dated November 10, 2010.

Current FDA labeling identifies EGRIFTA SV and EGRIFTA WR as specific tesamorelin pharmaceutical formulations. The FDA-approved indication is specific to reduction of excess abdominal fat in HIV-infected adults with lipodystrophy, and the label explicitly states that these products are not indicated for weight-loss management.

That approval applies to the specified FDA-regulated pharmaceutical products and formulations. It should not be interpreted as approval of this 10 mg research-grade lyophilized material.

Analytical Documentation

A Certificate of Analysis (COA) is included in the product image gallery. Researchers should review the batch-specific documentation to verify identity, reported purity, and other available analytical characteristics.

Tesamorelin acetate is a distinct salt form. PubChem reports a separate molecular formula and molecular weight for tesamorelin acetate, so the applicable batch documentation should be used when determining the exact chemical form of a supplied material.

Frequently Asked Questions

1. What type of peptide is tesamorelin?

Tesamorelin is a synthetic analogue of human growth hormone-releasing hormone (GHRH). It is structurally based on the 44-amino-acid GHRH sequence.

2. How many amino acids are in tesamorelin?

Tesamorelin contains 44 amino-acid residues in its peptide sequence, corresponding to the length of human GHRH. Its terminal chemistry differs from native GHRH.

3. What receptor is associated with tesamorelin research?

Tesamorelin is a GHRH analogue and is studied in relation to the growth hormone-releasing hormone receptor (GHRHR), which is expressed on pituitary somatotroph cells.

4. Is tesamorelin the same as natural GHRH?

No. Tesamorelin is a synthetic analogue based on human GHRH. Its peptide sequence has modified terminal chemistry that distinguishes it from the native hormone.

5. Is tesamorelin FDA approved?

Specific tesamorelin pharmaceutical products, including Egrifta and its later formulations, have FDA approval. That regulatory status applies to those defined pharmaceutical products and their labeled uses, not automatically to research-grade tesamorelin materials.

6. What should researchers check on the tesamorelin COA?

The batch-specific COA should be reviewed for identity, reported purity, analytical results, and chemical form. Researchers should use the supplied documentation when recording specifications for an individual batch.

Research Materials & Documentation

Tesamorelin | The 10 Pack contains 10 mg of lyophilized research material with ≥99% HPLC-certified purity. A Certificate of Analysis is included in the product image gallery for laboratory review.

Researchers should verify the batch-specific COA before incorporating the material into experimental or analytical workflows.

For Research Use Only | Not for Human or Veterinary Use.