| Specification | Details |
|---|---|
| Compound Name | Tesamorelin |
| Type | Synthetic GRF Analogue |
| Quantity | 10 mg |
| Purity | ≥99% (HPLC Certified) |
| Form | Lyophilized Powder |
| Appearance | White to Off-White Powder |
| Molecular Formula | C₂₂₁H₃₆₆N₇₂O₆₇S |
| Molecular Weight | 5,135.9 Da |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| CAS Number | 218949-48-5 |
| COA | Included in Product Image Gallery |
$89.99 Original price was: $89.99.$79.99Current price is: $79.99.
For Research Use Only | Not for Human or Veterinary Use
Tesamorelin is a synthetic peptide analogue of human growth hormone-releasing factor (GRF). It consists of a modified 44-amino-acid GRF sequence and has been characterized in biochemical and laboratory research involving GRF receptor signaling.
This research material is supplied as a lyophilized powder with a stated purity of ≥99% by HPLC. Each product includes a Certificate of Analysis (COA) for analytical reference.
The molecular formula, molecular weight, sequence, and CAS number are consistent with established chemical references and FDA documentation.
Tesamorelin is structurally related to human growth hormone-releasing factor (GRF). Its structure contains the 44-amino-acid GRF sequence with a modified N-terminal region, a feature that distinguishes tesamorelin from the native peptide.
Laboratory characterization has examined tesamorelin in relation to GRF receptor signaling. FDA clinical pharmacology documentation reports that tesamorelin binds and stimulates human GRF receptors in vitro.
These findings provide a biochemical basis for studying the compound in controlled research settings. Individual experimental findings should be interpreted according to the model, methodology, and conditions used in the relevant study.
The supplied product specification states a purity of ≥99% by HPLC. HPLC is a widely used analytical method for separating and characterizing components within a sample.
A Certificate of Analysis is included in the product image gallery for review of the available batch documentation. Researchers should refer to the applicable COA when evaluating lot-specific analytical information.
Tesamorelin is supplied as a white to off-white lyophilized powder. Lyophilization is a controlled drying process commonly used when preparing peptide-based research materials in a dry form.
The supplied material information identifies the product as a laboratory research material. Researchers should refer to the product documentation for material-specific handling and storage information.
Tesamorelin has an established pharmaceutical history, and FDA documentation identifies tesamorelin as a synthetic GRF analogue. The FDA-approved products described in its labeling are separate from the research material offered on this page.
This product is presented specifically as a research-use material and should be evaluated according to the applicable laboratory research requirements and jurisdictional rules.
Tesamorelin is a synthetic analogue of human growth hormone-releasing factor (GRF), containing a modified 44-amino-acid GRF sequence.
The reported peptide sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL.
GRF stands for growth hormone-releasing factor, a peptide involved in signaling through GRF receptors. Tesamorelin is structurally related to this naturally occurring signaling peptide.
The supplied material is listed as ≥99% HPLC certified. High-Performance Liquid Chromatography can be used to characterize and evaluate components within a peptide sample.
Tesamorelin is a modified synthetic analogue of human GRF. Its structure retains the 44-amino-acid GRF sequence while incorporating an N-terminal chemical modification.
The product's Certificate of Analysis is included in the product image gallery. Batch documentation can be reviewed for the analytical information associated with the supplied material.
Review the Tesamorelin specifications and available Certificate of Analysis when evaluating this material for laboratory research.